• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated FKBP8 Monoclonal antibody

FKBP8 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66690
Clone No.1C1G12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

FK506 binding protein 8, FK506-binding protein 8, FKBP 38, FKBP 8, FKBP38

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66690 targets FKBP8 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1649

Product name: Recombinant human FKBP8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-355 aa of BC009966

Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

Predict reactive species
Full Name FK506 binding protein 8, 38kDa
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC009966
Gene Symbol FKBP8
Gene ID (NCBI) 23770
RRIDAB_3084721
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14318
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
FC protocol for CL594 FKBP8 antibody CL594-66690Download protocol
IF protocol for CL594 FKBP8 antibody CL594-66690Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...