CoraLite® Plus 488-conjugated FKBP8 Monoclonal antibody

• 

  IF Staining of A431 using CL488-66690

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 FKBP8 antibody (CL488-66690, Clone: 1C1G12 ) at dilution of 1:200, CL594-phalloidin (red).

• 

  FC experiment of A431 using CL488-66690

  1X10^6 A431 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human FKBP8 (CL488-66690, Clone:1C1G12) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

FKBP8 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66690

Clone No.1C1G12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

FKBP-38, FKBP38, FKBP 8, FKBP 38, FK506-binding protein 8

---

Tested Applications

• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66690 targets FKBP8 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1649

  Product name: Recombinant human FKBP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC009966

  Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

• Full Name: FK506 binding protein 8, 38kDa
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC009966
• Gene Symbol: FKBP8
• Gene ID (NCBI): 23770
• RRID: AB_3084266
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14318
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.