CoraLite® Plus 488-conjugated PSMA/GCPII Monoclonal antibody

PSMA/GCPII Monoclonal Antibody for IF-P
Cat No. CL488-66678
Clone No.3G4E12

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF-P

FOLH1, PSMA, 3G4E12, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman prostate cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66678 targets PSMA/GCPII in IF-P applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16594

Product name: Recombinant human FOLH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 45-385 aa of BC025672

Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG

Predict reactive species
Full Name folate hydrolase (prostate-specific membrane antigen) 1
Calculated Molecular Weight 719 aa, 81 kDa
Observed Molecular Weight 100-120 kDa
GenBank Accession NumberBC025672
Gene Symbol PSMA
Gene ID (NCBI) 2346
RRIDAB_2919356
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ04609
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PSMA/GCPII antibody CL488-66678Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...