CoraLite®594-conjugated PSMA/GCPII Monoclonal antibody

• 

  IF Staining of human prostate cancer using CL594-66678

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using CoraLite®594 PSMA/GCPII antibody (CL594-66678, Clone: 3G4E12 ) at dilution of 1:200.

PSMA/GCPII Monoclonal Antibody for IF-P

Cat No. CL594-66678

Clone No.3G4E12

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF-P

Synonyms

FOLH1, PSMA, 3G4E12, Cell growth-inhibiting gene 27 protein, EC:3.4.17.21

---

Tested Applications

• Positive IF-P detected in: human prostate cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66678 targets PSMA/GCPII in IF-P applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16594

  Product name: Recombinant human FOLH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 45-385 aa of BC025672

  Sequence: SSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGG

• Full Name: folate hydrolase (prostate-specific membrane antigen) 1
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC025672
• Gene Symbol: PSMA
• Gene ID (NCBI): 2346
• RRID: AB_2920020
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q04609
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PSMA(Prostate-specific membrane antigen) is also named as FOLH1, FOLH, NAALAD1, PSM and belongs to the peptidase M28 family. PSMA is a 100-120 kDa integral transmembrane glycoprotein, considered to be a highly specific marker of the prostate gland, and has successfully been used as a marker of circulating prostatic epithelial cells(PMID:10074909; 15680901). It is involved in conversion of the major neurotransmitter (NAAG) to NAA and free glutamate. It has 8 isoforms produced by alternative splicing.