CoraLite®594-conjugated Factor XII Monoclonal antibody

Factor XII Monoclonal Antibody for IF/ICC
Cat No. CL594-66089
Clone No.2E2F11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC

F12, Factor 12, EC:3.4.21.38, Coagulation factor XII, Beta-factor XIIa part 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66089 targets Factor XII in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3401

Product name: Recombinant human F12 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 316-615 aa of BC012390

Sequence: MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS

Predict reactive species
Full Name coagulation factor XII (Hageman factor)
Calculated Molecular Weight 615 aa, 68 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC012390
Gene Symbol Factor XII
Gene ID (NCBI) 2161
RRIDAB_2883506
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00748
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Factor XII (F XII, Hageman factor) is a 80 kDa, single chain glycoprotein that circulates in blood as an inactive zymogen. F XII plays an important role in blood coagulation, fibrinolysis, and kinin generation. Factor XII is activated by kallikrein in alpha-factor XIIa, which is further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of a 52 kDa NH2-terminal heavy chain, called coagulation factor XIIa heavy chain, and a 28 kDa COOH-terminal light chain, called coagulation factor XIIa light chain, connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, an N-terminal nonapeptide, called beta-factor XIIa part 1, and coagulation factor XIIa light chain, also known in this context as beta-factor XIIa part 2.

Protocols

Product Specific Protocols
IF protocol for CL594 Factor XII antibody CL594-66089Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...