• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated GABARAPL1 Polyclonal antibody

GABARAPL1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-11010

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

APG8 LIKE, APG8L, ATG8, ATG8L, Early estrogen-regulated protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inChloroquine treated HepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-11010 targets GABARAPL1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1473

Product name: Recombinant human ATG8L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-117 aa of BC009309

Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Predict reactive species
Full Name GABA(A) receptor-associated protein like 1
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC009309
Gene Symbol GABARAPL1
Gene ID (NCBI) 23710
RRIDAB_2934840
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H0R8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GABARAPL1 (GABARAP-like protein 1), also named as ATG8, GEC1, APG8L, ATG8L and APG8-LIKE, is a member of GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2, and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle and at very low levels in thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 GABARAPL1 antibody CL647-11010Download protocol
IF protocol for CL Plus 647 GABARAPL1 antibody CL647-11010Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...