Tested Applications
| Positive IF/ICC detected in | Chloroquine treated HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-11010 targets GABARAPL1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1473 Product name: Recombinant human ATG8L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC009309 Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Predict reactive species |
| Full Name | GABA(A) receptor-associated protein like 1 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC009309 |
| Gene Symbol | GABARAPL1 |
| Gene ID (NCBI) | 23710 |
| RRID | AB_2934840 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0R8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
GABARAPL1 (GABARAP-like protein 1), also named as ATG8, GEC1, APG8L, ATG8L and APG8-LIKE, is a member of GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as estrogen-regulated gene and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy like GABARAP and GABARAPL2, and may be considered as an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle and at very low levels in thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 647 GABARAPL1 antibody CL647-11010 | Download protocol |
| FC protocol for CL Plus 647 GABARAPL1 antibody CL647-11010 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



