CoraLite® Plus 488-conjugated GIT2 Monoclonal antibody

• 

  FC experiment of HeLa using CL488-67858

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human GIT2 (CL488-67858, Clone:2D9C5) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

GIT2 Monoclonal Antibody for FC (Intra)

Cat No. CL488-67858

Clone No.2D9C5

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

FC (Intra)

Synonyms

2D9C5, ARF GAP GIT2, ARF GTPase-activating protein GIT2, CAT 2, CAT2

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67858 targets GIT2 in FC (Intra) applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0321

  Product name: Recombinant human GIT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-462 aa of BC001379

  Sequence: DSSLDLSELAKAAKKKLQSLSNHLFEELAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQ

• Full Name: G protein-coupled receptor kinase interacting ArfGAP 2
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC001379
• Gene Symbol: GIT2
• Gene ID (NCBI): 9815
• RRID: AB_2934576
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14161
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.