CoraLite®594-conjugated GLUD1 Monoclonal antibody

GLUD1 Monoclonal Antibody for IF-P
Cat No. CL594-67026
Clone No.4G10D3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

IF-P

GDH, GDH 1, GDH1, GLUD, GLUD1, glutamate dehydrogenase 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67026 targets GLUD1 in IF-P applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6179

Product name: Recombinant human GLUD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 214-558 aa of BC040132

Sequence: FIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT

Predict reactive species
Full Name glutamate dehydrogenase 1
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC040132
Gene Symbol GLUD1
Gene ID (NCBI) 2746
RRIDAB_2920074
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00367
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human glutamate dehydrogenase (GDH), an enzyme central to the metabolism of glutamate, is known to exist in housekeeping and nerve tissue-specific isoforms encoded by the GLUD1 and GLUD2 genes, respectively. It catalyses the reversible inter-conversion of glutamate to alpha-ketoglutarate and ammonia, thus interconnecting amino acid and carbohydrate metabolism. GLUD1 might contribute to the formation of specific synapses in the hippocampus such as those formed by the projecting neurons of the entorhinal cortex(PMID: 22138648). GLUD1 has a calculated molecular mass of 61 kDa and an apparent molecular mass of 45-55 kDa with the 53aa transit peptide removed.

Protocols

Product Specific Protocols
IF protocol for CL594 GLUD1 antibody CL594-67026Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...