• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated GOLPH3 Polyclonal antibody

GOLPH3 Polyclonal Antibody for IF/ICC
Cat No. CL488-19112

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Coat protein GPP34, FLJ90675, Golgi phosphoprotein 3, GOLPH3, GOPP1, GPP34, MIDAS

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-19112 targets GOLPH3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5443

Product name: Recombinant human GOLPH3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-298 aa of BC033725

Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

Predict reactive species
Full Name golgi phosphoprotein 3 (coat-protein)
Calculated Molecular Weight 298 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC033725
Gene Symbol GOLPH3
Gene ID (NCBI) 64083
RRIDAB_3084022
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H4A6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GOLPH3 (also called GPP34, GMx33, MIDAS, or yeast Vps74p) is a 34-kDa Golgi-associated protein conserved from yeast to human. GOLPH3 binds to PtdIns(4)P-rich trans-Golgi membranes and MYO18A conveying a tensile force required for efficient tubule and vesicle formation (PMID: 19837035). GOLPH3 has been recently demonstrated as a novel oncoprotein amplified in various types of human malignancies, including melanoma, breast, non-small cell lung cancer, gliomas and connective tissue tumors (PMID:19553991; 23006319; 21499727; 22745132). Enhanced activation of mTOR signalling represents a molecular basis for the oncogenic activity of GOLPH3 (PMID: 19553991).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GOLPH3 antibody CL488-19112Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...