• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated GPR37/Pael-R Polyclonal antibody

GPR37/Pael-R Polyclonal Antibody for IF-P
Cat No. CL594-14820

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

GPR37, Pael-R, EDNRBL, Endothelin B receptor-like protein 1, ETBR LP 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-14820 targets GPR37/Pael-R in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6591

Product name: Recombinant human GPR37 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 34-264 aa of BC040007

Sequence: SRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAV

Predict reactive species
Full Name G protein-coupled receptor 37 (endothelin receptor type B-like)
Calculated Molecular Weight 67 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC040007
Gene Symbol GPR37
Gene ID (NCBI) 2861
RRIDAB_2934705
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15354
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). This antibody recognizes endogenous GPR37, which migrates as an approximately 50-55 kDa band in SDS-PAGE (PMID:17519329).

Protocols

Product Specific Protocols
IF protocol for CL594 GPR37/Pael-R antibody CL594-14820Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...