CoraLite® Plus 488-conjugated GRK1 Recombinant monoclonal antibody

• 

  IF Staining of mouse eye using CL488-85942

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using CoraLite® Plus 488 GRK1 antibody (CL488-85942, Clone: 250433A4 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse eye using CL488-85942

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using CoraLite® Plus 488 GRK1 antibody (CL488-85942, Clone: 250433A4 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GRK1 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-85942

Clone No.250433A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

EC:2.7.11.14, G protein-coupled receptor kinase 1, GPRK1, Rhodopsin kinase, Rhodopsin kinase GRK1

---

Tested Applications

• Positive IF-P detected in: mouse eye tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85942 targets GRK1 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18063

  Product name: Recombinant human GRK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 339-563 aa of BC140945

  Sequence: AVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS

• Full Name: G protein-coupled receptor kinase 1
• Calculated Molecular Weight: 563 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC140945
• Gene Symbol: GRK1
• Gene ID (NCBI): 6011
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15835
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GRK1(G protein-coupled receptor kinase 1) is also named as RHOK, RK, GPRK1, and belongs to the AGC Ser/Thr protein kinase family. It is involved in quenching of light-induced signal transduction in the phosphoreceptor. GRK1 is a photoreceptor-specific enzyme that mediates adaptation of photoreceptors to light and protects these cells against light-induced injury.