CoraLite® Plus 488-conjugated GSPT2 Recombinant monoclonal antibody

GSPT2 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-86508-3
Clone No.251224C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

EC:3.6.5.-, eRF3b, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition 2, GST2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86508-3 targets GSPT2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3641

Product name: Recombinant human GSPT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC036077

Sequence: MDSGSSSSDSAPDCWDQVDMESTGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPK

Predict reactive species
Full Name G1 to S phase transition 2
Calculated Molecular Weight 628 aa, 69 kDa
Observed Molecular Weight 69-75 kDa
GenBank Accession NumberBC036077
Gene Symbol GSPT2
Gene ID (NCBI) 23708
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IYD1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GSPT2, also named as eukaryotic peptide chain release factor GTP-binding subunit ERF3B or G1 to S phase transition protein 2 homolog, is a 628 amino acid protein, which belongs to the GTP-binding elongation factor family ERF3 subfamily. GSPT2 localizes in the cytoplasm and is highly expressed in IUCC stage II colorectal cancer (CRC). GSPT2 is involved in translation termination in response to the termination codons UAA, UAG, and UGA and may play a role as a potent stimulator of the release factor activity of ETF1. It may play a role in cell cycle progression.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GSPT2 antibody CL488-86508-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...