CoraLite® Plus 488-conjugated GSPT2 Recombinant monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-86508-3

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite® Plus 488 GSPT2 antibody (CL488-86508-3, Clone: 251224C9 ) at dilution of 1:200.

GSPT2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86508-3

Clone No.251224C9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

EC:3.6.5.-, eRF3b, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition 2, GST2

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86508-3 targets GSPT2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3641

  Product name: Recombinant human GSPT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC036077

  Sequence: MDSGSSSSDSAPDCWDQVDMESTGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPK

• Full Name: G1 to S phase transition 2
• Calculated Molecular Weight: 628 aa, 69 kDa
• Observed Molecular Weight: 69-75 kDa
• GenBank Accession Number: BC036077
• Gene Symbol: GSPT2
• Gene ID (NCBI): 23708
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IYD1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GSPT2, also named as eukaryotic peptide chain release factor GTP-binding subunit ERF3B or G1 to S phase transition protein 2 homolog, is a 628 amino acid protein, which belongs to the GTP-binding elongation factor family ERF3 subfamily. GSPT2 localizes in the cytoplasm and is highly expressed in IUCC stage II colorectal cancer (CRC). GSPT2 is involved in translation termination in response to the termination codons UAA, UAG, and UGA and may play a role as a potent stimulator of the release factor activity of ETF1. It may play a role in cell cycle progression.