CoraLite® Plus 488-conjugated GSTM3 Monoclonal antibody

• 

  IF Staining of A431 using CL488-67634

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CoraLite® Plus 488 GSTM3 antibody (CL488-67634, Clone: 1E2B8 ) at dilution of 1:600.

GSTM3 Monoclonal Antibody for IF/ICC

Cat No. CL488-67634

Clone No.1E2B8

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig

Applications

IF/ICC

Synonyms

Glutathione S transferase Mu 3, GST class mu 3, GST5, GSTB, GSTM3, GSTM3 3, GTM3, hGSTM3 3

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67634 targets GSTM3 in IF/ICC applications and shows reactivity with Human, pig samples.

• Tested Reactivity: Human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7494

  Product name: Recombinant human GSTM3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC000088

  Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC

• Full Name: glutathione S-transferase mu 3 (brain)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC000088
• Gene Symbol: GSTM3
• Gene ID (NCBI): 2947
• RRID: AB_3084366
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21266
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer.