CoraLite® Plus 750-conjugated HEBP1 Recombinant monoclonal antibody

• 

  WB analysis using CL750-82950

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-82950 (HEBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

HEBP1 Uni-rAb^® Recombinant Antibody for WB

Cat No. CL750-82950

Clone No.230156B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB

Synonyms

230156B6, HBP, HEBP, HEBP 1, heme binding protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-82950 targets HEBP1 in WB applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10538

  Product name: Recombinant human HEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-189 aa of BC016277

  Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT

• Full Name: heme binding protein 1
• Calculated Molecular Weight: 189 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC016277
• Gene Symbol: HEBP1
• Gene ID (NCBI): 50865
• RRID: AB_3673751
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRV9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.