HIC5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HIC5 Polyclonal antibody, PBS Only (10565-1-PBS)

• 

  WB analysis using 10565-1-AP (same clone as 10565-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10565-1-AP (HIC5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10565-1-AP (same clone as 10565-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10565-1-AP (HIC5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 10565-1-AP (same clone as 10565-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 10565-1-AP (HIC5 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A431 using 10565-1-AP (same clone as 10565-1-PBS)

  IP result of anti-HIC5 (IP:10565-1-AP, 4ug; Detection:10565-1-AP 1:500) with A431 cells lysate 1520ug. This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 10565-1-AP (same clone as 10565-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 10565-1-AP (HIC5 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 10565-1-AP (same clone as 10565-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 10565-1-AP (HIC5 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 10565-1-AP (same clone as 10565-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using HIC5 antibody (10565-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 10565-1-AP (same clone as 10565-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using HIC5 antibody (10565-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10565-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HIC5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10565-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Androgen receptor-associated protein of 55 kDa, ARA55, Hic-5, Hydrogen peroxide-inducible clone 5 protein, TGFB1I1

---

Product Information

10565-1-PBS targets HIC5 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0868

  Product name: Recombinant human TGFB1I1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC001830

  Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAW

• Full Name: transforming growth factor beta 1 induced transcript 1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC001830
• Gene Symbol: HIC5
• Gene ID (NCBI): 7041
• RRID: AB_2202045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43294
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.