CoraLite® Plus 488-conjugated HLA-F Monoclonal antibody

HLA-F Monoclonal Antibody for IF/ICC
Cat No. CL488-66819
Clone No.1B12C2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

HLA F antigen, HLA F, HLA CDA12, HLA 5.4, CDA12

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inRaji cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66819 targets HLA-F in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6475

Product name: Recombinant human HLA-F protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 21-298 aa of BC062991

Sequence: AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS

Predict reactive species
Full Name major histocompatibility complex, class I, F
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberBC062991
Gene Symbol HLA-F
Gene ID (NCBI) 3134
RRIDAB_3672923
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP30511
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-F is a non-classical MHC class I molecule. (PMID: 667938; 3375250; 2249951)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HLA-F antibody CL488-66819Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...