CoraLite® Plus 488-conjugated HLA class I ABC Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL488-66013

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CL488-66013 (HLA class I ABC antibody) at dilution of 1:50.

• 

  IF Staining of Raji using CL488-66013

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CoraLite® Plus 488 HLA class I ABC antibody (CL488-66013, Clone: 5C5B7 ) at dilution of 1:200.

• 

  FC experiment of Raji using CL488-66013

  1X10^6 Raji cells were surface stained with 0.4 ug CoraLite® Plus 488 Anti-Human HLA class I ABC (CL488-66013, Clone:5C5B7) (red), or 0.4 ug CoraLite® Plus 488 Mouse IgG2b Isotype Control (MPC-11) (CL488-65128, Clone: MPC-11) (blue). Cells were not fixed.

• Featured Product
• KD/KO Validated

HLA class I ABC Monoclonal Antibody for IF/ICC, IF-P, FC

Cat No. CL488-66013

Clone No.5C5B7

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

IF/ICC, IF-P, FC

Synonyms

HLA-A, HLA class I histocompatibility antigen, A alpha chain, HLA class I (HLA-A), HLA class I, HLA A

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue, Raji cells
• Positive IF/ICC detected in: Raji cells
• Positive FC detected in: Raji cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66013 targets HLA class I ABC in IF/ICC, IF-P, FC applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7488

  Product name: Recombinant human HLA class I (HLA-A) protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 28-303 aa of BC003069

  Sequence: SMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQ

• Full Name: major histocompatibility complex, class I, A
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 40-44 kDa
• GenBank Accession Number: BC003069
• Gene Symbol: HLA-A
• Gene ID (NCBI): 3105
• RRID: AB_2883227
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04439
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)