• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HLA class I ABC Monoclonal antibody

HLA class I ABC Monoclonal Antibody for IF/ICC, IF-P, FC
Cat No. CL488-66013
Clone No.5C5B7

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

IF/ICC, IF-P, FC

HLA-A, HLA class I histocompatibility antigen, A alpha chain, HLA class I (HLA-A), HLA class I, HLA A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue, Raji cells
Positive IF/ICC detected inRaji cells
Positive FC detected inRaji cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66013 targets HLA class I ABC in IF/ICC, IF-P, FC applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7488

Product name: Recombinant human HLA class I (HLA-A) protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 29-302 aa of BC003069

Sequence: MRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS

Predict reactive species
Full Name major histocompatibility complex, class I, A
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 40-44 kDa
GenBank Accession NumberBC003069
Gene Symbol HLA-A
Gene ID (NCBI) 3105
RRIDAB_2883227
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04439
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and β2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 HLA class I ABC antibody CL488-66013Download protocol
IF protocol for CL Plus 488 HLA class I ABC antibody CL488-66013Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...