• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated HSP27 Monoclonal antibody

HSP27 Monoclonal Antibody for IF/ICC
Cat No. CL594-66767
Clone No.3E7A1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

28 kDa heat shock protein, CMT2F, DKFZp586P1322, Heat shock 27 kDa protein, heat shock 27kDa protein 1, Heat shock protein beta 1, HMN2B, HS.76067, HSP 27, Hsp25, HSP27, HSP28, HSPB1, SRP27, Stress responsive protein 27

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66767 targets HSP27 in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27859

Product name: Recombinant human HSPB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-205 aa of BC012768

Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predict reactive species
Full Name heat shock 27kDa protein 1
Calculated Molecular Weight 19-23 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC012768
Gene Symbol HSPB1
Gene ID (NCBI) 3315
RRIDAB_2920032
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04792
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).

Protocols

Product Specific Protocols
IF protocol for CL594 HSP27 antibody CL594-66767Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...