• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated HSP27 Monoclonal antibody

HSP27 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66767
Clone No.3E7A1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

HSPB1, 3E7A1, CMT2F, Estrogen-regulated 24 kDa protein, HMN2B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66767 targets HSP27 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27859

Product name: Recombinant human HSPB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-205 aa of BC012768

Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Predict reactive species
Full Name heat shock 27kDa protein 1
Calculated Molecular Weight 19-23 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC012768
Gene Symbol HSPB1
Gene ID (NCBI) 3315
RRIDAB_2919365
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04792
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HSP27 antibody CL488-66767Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...