CoraLite® Plus 647-conjugated IgA Monoclonal antibody

Human IgA Monoclonal Antibody for IF-P
Cat No. CL647-60099
Clone No.3A5A5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

FLJ14473, FLJ35065, FLJ35500, FLJ36402, FLJ39698, FLJ40001, FLJ41548, FLJ41552, FLJ41789, FLJ43248, FLJ43594, FLJ44293, FLJ46028, FLJ46621, FLJ46724, FLJ46811, FLJ46824, FLJ90170, IgA1, IGHA1

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60099 targets Human IgA in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7417

Product name: Recombinant human IgA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 4-353 aa of BC016369

Sequence: TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

Predict reactive species
Full Name immunoglobulin heavy constant alpha 1
Calculated Molecular Weight 496 aa, 53 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC016369
Gene Symbol Human IgA Heavy Chain
Gene ID (NCBI) 3493
RRIDAB_2920242
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein G purification
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. This antibody recognizes the Chain C region of human Ig alpha-1 (IGHA1).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 Human IgA antibody CL647-60099Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...