CoraLite® Plus 647-conjugated IBA1 Monoclonal antibody

IBA1 antibodies are primarily used as markers for microglia, the resident immune cells of the central nervous system, and for macrophages in peripheral tissues. Proteintech has an extensive validated IBA1 antibodies for IHC, IF-P, IF-Fro, ELISA and more.
Cat No. CL647-66827
Clone No.1C6A10

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

FC (Intra)

AIF1, 1C6A10, AIF 1, AIF-1, allograft inflammatory factor 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66827 targets IBA1 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28236

Product name: Recombinant human IBA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-147 aa of BC009474

Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predict reactive species
Full Name allograft inflammatory factor 1
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC009474
Gene Symbol IBA1
Gene ID (NCBI) 199
ENSEMBL Gene IDENSG00000204472
RRIDAB_2935068
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP55008
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AIF1, also named as G1, IBA1 or daintain/AIF-1, is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Despite a lack of detailed knowledge on the in vivo physiological functions of AIF-1, there is growing evidence that shows its aberrant expression contributes to the pathogenesis of many autoimmune diseases, including rheumatoid arthritis. (20944424). AIF1 is an actin-binding protein that enhances membrane ruffling and RAC activation. It enhances lymphocyte migration and the actin-bundling activity of LCP1. AIF1 plays a role in RAC signaling and in phagocytosis and a role in vascular inflammation. AIF1 promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. It is also as a microglial cell marker.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 IBA1 antibody CL647-66827Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Acta Pharm Sin B

Drofenine as a Kv2.1 inhibitor alleviated AD-like pathology in mice through Aβ/Kv2.1/microglial NLRP3/neuronal Tau axis

Authors - Jian Lu
Loading...
||
New chat Able
正在加载,请稍候...