Home
Products
Primary Antibodies
IGF2BP2 Polyclonal antibody, PBS Only (11601-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis using 11601-1-AP (same clone as 11601-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
WB analysis of human heart using 11601-1-AP (same clone as 11601-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 11601-1-AP (same clone as 11601-1-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
WB analysis of human kidney using 11601-1-AP (same clone as 11601-1-PBS)
human kidney tissue were subjected to SDS PAGE followed by western blot with 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IP experiment of HEK-293 using 11601-1-AP (same clone as 11601-1-PBS)
IP result of anti-IGF2BP2 (IP:11601-1-AP, 3ug; Detection:11601-1-AP 1:500) with HEK-293 cells lysate 1000ug. This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11601-1-AP (IGF2BP2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11601-1-AP (IGF2BP2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 11601-1-AP (same clone as 11601-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11601-1-AP (IGF2BP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 11601-1-AP (same clone as 11601-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IGF2BP2 antibody (11601-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11601-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

IGF2BP2 Polyclonal antibody, PBS Only

Name: IGF2BP2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11601-1-PBS

IGF2BP2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11601-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

IGF2 mRNA-binding protein 2, IGF-II mRNA-binding protein 2, IMP2, IMP-2, insulin like growth factor 2 mRNA binding protein 2

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11601-1-PBS targets IGF2BP2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2142 Product name: Recombinant human IGF2BP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC021290 Sequence: MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIM Predict reactive species
Full Name	insulin-like growth factor 2 mRNA binding protein 2
Calculated Molecular Weight	65 kDa
Observed Molecular Weight	55-65 kDa
GenBank Accession Number	BC021290
Gene Symbol	IGF2BP2
Gene ID (NCBI)	10644
RRID	AB_2122672
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y6M1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Insulin-like growth factor 2 mRNA-binding protein 2(IGF2BP2), ia a member of a family of mRNA binding protein, which can bind to several mammalian cells' mRNAs. Thus it may involve in the regulation of translation of mRNA. IGF2BP2's polymorphisms is risk factor for developing type 2 diabetes. This antibody raise against part of N-terminus of human IGF2BP2. IGF2BP2 has some isoforms with the MW of 54-66 kDa. Some literature has reported that multiple bands can be detected (PMID: 22427968, 36322753, 23069990).