Use Able AI chat for product recommendations

Ig Lambda Light Chain Polyclonal antibody

Ig Lambda Light Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, IP, ELISA

IgG Lambda Light Chain, IGL, IgG, IGL-, immunoglobulin lambda locus

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Ig Lambda Light Chain in ?

Tested Applications

Positive WB detected inhuman plasma tissue, human spleen tissue
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:10000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11541-1-AP targets Ig Lambda Light Chain in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2064

Product name: Recombinant human IGL- protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-237 aa of BC020233

Sequence: MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Predict reactive species
Full Name immunoglobulin lambda locus
Calculated Molecular Weight 237 aa, 25 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC020233
Gene Symbol IgG Lambda Light Chain
Gene ID (NCBI) 3535
RRIDAB_2877775
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detects the lambda light chain of human immunoglobulin.

Protocols

Product Specific Protocols
FC protocol for Ig Lambda Light Chain antibody 11541-1-APDownload protocol
IF protocol for Ig Lambda Light Chain antibody 11541-1-APDownload protocol
IHC protocol for Ig Lambda Light Chain antibody 11541-1-APDownload protocol
WB protocol for Ig Lambda Light Chain antibody 11541-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Ig Lambda Light Chain Polyclonal antibody (Cat# 11541-1-AP) has 4 citations published in Cell Death & Disease, Proceedings of the National Academy of Sciences, Cancer Immunology, Immunotherapy, and World Journal of Diabetes. The associated research spans colorectal cancer progression and NK-cell immune surveillance, AL amyloidosis structural biology, and diabetic kidney disease involving autophagy-dependent ferroptosis pathways.

SpeciesApplicationTitle
humanIP

Cell Death Dis

SLC44A2 negatively regulates mitochondrial fatty acid oxidation to suppress colorectal progression by blocking the MUL1-CPT2 interaction.

Authors - Ying Yang

Proc Natl Acad Sci U S A

Biopsy-resolved cryo-EM structures of amyloid fibrils provide molecular insights into AL amyloidosis.

Authors - Yuxuan Yao
humanWB

Cancer Immunol Immunother

A high proportion of CD38 (high) CD16 (low) NK cells in colorectal cancer can interrupt immune surveillance and favor tumor growth

Authors - Xueling Wang
humanWB,IHC,IF,ELISA

World J Diabetes

Nephroprotective mechanism of Kunkui Baoshen decoction in diabetic kidney disease: Targeting the HERC2/NCOA4-mediated autophagy-dependent ferroptosis pathway.

Authors - Si-Yuan Song
Loading...
||
New chat

Able™

正在加载,请稍候...