HRP-conjugated Ig Lambda Light Chain Polyclonal antibody

• 

  WB analysis using HRP-11541

  Human plasma were subjected to SDS PAGE followed by western blot with HRP-11541 (IgG Lambda Light Chain antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

Ig Lambda Light Chain Polyclonal Antibody for WB

Cat No. HRP-11541

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB

Synonyms

IgG Lambda Light Chain, IGL, IgG, IGL-, immunoglobulin lambda locus

---

Tested Applications

• Positive WB detected in: human plasma

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

HRP-11541 targets Ig Lambda Light Chain in WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2064

  Product name: Recombinant human IGL- protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC020233

  Sequence: MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

• Full Name: immunoglobulin lambda locus
• Calculated Molecular Weight: 237 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC020233
• Gene Symbol: IgG Lambda Light Chain
• Gene ID (NCBI): 3535
• RRID: AB_2920507
• Conjugate: HRP
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

This antibody detects the lambda light chain of human immunoglobulin.