FcZero-rAb® PE Anti-Human IL-1 beta Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® PE Anti-Human IL-1 beta Rabbit Recombinant Antibody (PE-FcA98142)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

IL-1 beta FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. PE-FcA98142

Clone No.240902A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

Catabolin, IL 1, IL 1 beta, IL1 beta, IL1- beta

• 

  FC experiment of human PBMCs using PE-FcA98142

  1x10^6 untreated or IFN gamma, LPS and Brefeldin A-treated human PBMCs were intracellularly stained with 5 ul PE Anti-Human IL-1 beta Rabbit RecAb (PE-FcA98142, Clone: 240902A3). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98142 targets IL-1 beta in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0286

  Product name: Recombinant Human IL-1 Beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*HIS

  Domain: 117-269 aa of BC008678

  Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Full Name: interleukin 1, beta
• Calculated Molecular Weight: 269 aa, 31 kDa
• GenBank Accession Number: BC008678
• Gene Symbol: IL1B
• Gene ID (NCBI): 3553
• ENSEMBL Gene ID: ENSG00000125538
• RRID: AB_3749785
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01584
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions.