CoraLite® Plus 405 Anti-Mouse IL-17F Rabbit Recombinant Antibody

IL-17F Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL405-98019
Clone No.230026G6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Il17f, 230026G6, C87042, IL 17F, IL-17

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inPMA, Ionomycin and Brefeldin A treated C57BL/6 Th17-polarized splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL405-98019 targets IL-17F in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0671

Product name: Recombinant Mouse IL-17F protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 29-161 aa of NM_145856.2

Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Predict reactive species
Full Name interleukin 17F
Calculated Molecular Weight17KD
GenBank Accession NumberNM_145856.2
Gene Symbol IL-17F
Gene ID (NCBI) 257630
RRIDAB_3672409
Conjugate CoraLite® Plus 405 Fluorescent Dye
Excitation/Emission Maxima Wavelengths399 nm / 422 nm
Excitation LaserViolet Laser (405 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7TNI7-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines, IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases. IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A/A or IL-17F/F homodimers, IL-17A/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 405 IL-17F antibody CL405-98019Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...