CoraLite®594-conjugated INA Monoclonal antibody

INA Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67120
Clone No.3C12A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

Alpha internexin, 66 kDa neurofilament protein, Alpha Inx, Alpha-internexin, Alpha-Inx

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67120 targets INA in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13655

Product name: Recombinant human INA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC006359

Sequence: MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR

Predict reactive species
Full Name internexin neuronal intermediate filament protein, alpha
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 60-66 kDa
GenBank Accession NumberBC006359
Gene Symbol INA
Gene ID (NCBI) 9118
RRIDAB_2934757
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16352
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

INA, also named as Alpha internexin, is a 66 kDa intermediate filament protein which is involved in the morphogenesis of neurons. INA is mainly expressed in various kinds of central and peripheral neurons from early development and highly expressed in neurodegenerative and neuronal death cells. The MW of INA ranges from 60 kDa in human, pig and mouse to 66 kDa in rat.(PMID: 29940892, 2201753)

Protocols

Product Specific Protocols
IF protocol for CL594 INA antibody CL594-67120Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...