IPO7 Monoclonal antibody, PBS Only

• 

  WB analysis using 67525-1-Ig (same clone as 67525-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67525-1-Ig (IPO7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67525-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67525-1-Ig (same clone as 67525-1-PBS)

  WB result of IPO7 antibody (67525-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-IPO7 transfected A549 cells. This data was developed using the same antibody clone with 67525-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67525-1-Ig (same clone as 67525-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67525-1-Ig (IPO7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67525-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67525-1-Ig (same clone as 67525-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67525-1-Ig (IPO7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67525-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67525-1-Ig (same clone as 67525-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67525-1-Ig (IPO7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67525-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IPO7 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67525-1-PBS

Clone No.1E7C12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

1E7C12, Imp7, importin 7, Ran binding protein 7, RANBP7

---

Product Information

67525-1-PBS targets IPO7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27257

  Product name: Recombinant human IPO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 879-1016 aa of NM_006391.2

  Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG

• Full Name: importin 7
• Calculated Molecular Weight: 120 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_006391.2
• Gene Symbol: IPO7
• Gene ID (NCBI): 10527
• RRID: AB_2882745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95373
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.