CoraLite®594-conjugated Ig Lambda Light Chain Polyclonal antibody

• 

  IF Staining of human tonsillitis using CL594-20758

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite®594 IgG Lambda Light Chain antibody (CL594-20758) at dilution of 1:200.

Ig Lambda Light Chain Polyclonal Antibody for IF-P

Cat No. CL594-20758

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

Synonyms

Human IgG Lambda Light Chain, Human IgG lambda chain, IgG Lambda Light Chain, IGLC1, IGLC

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-20758 targets Ig Lambda Light Chain in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14693

  Product name: Recombinant human IGLC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC007782

  Sequence: MAWTVLLLGLLSHCTGSGTSYVLTQPASVSVAPGQTARITCGGSNLGSKSVNWYQLRPGQAPILVVYENKERPAGIPERLSALTSEETATLTISSVVAGDEADYFCQVWDTTSQQYVFGTGTQVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

• Full Name: immunoglobulin lambda constant 1 (Mcg marker)
• Calculated Molecular Weight: 233 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC007782
• Gene Symbol: IgG Lambda Light Chain
• Gene ID (NCBI): 3537
• RRID: AB_2919856
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

This antibody detects the lambda light chain of human immunoglobulin.