Human Ig Lambda Light Chain Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Human Ig Lambda Light Chain Polyclonal antibody (20758-1-AP)

Human Ig Lambda Light Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 20758-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Synonyms

Human IgG Lambda Light Chain, Human IgG lambda chain, IgG Lambda Light Chain, IGLC1, IGLC

• 

  WB analysis of human plasma using 20758-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 20758-1-AP (Human IgG Lambda Light Chain antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 20758-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20758-1-AP (Human IgG Lambda Light Chain antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 20758-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 20758-1-AP (Human IgG Lambda Light Chain antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 20758-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using Human IgG Lambda Light Chain antibody (20758-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Human Ig Lambda Light Chain in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human plasma tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20758-1-AP targets Human Ig Lambda Light Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14693

  Product name: Recombinant human IGLC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC007782

  Sequence: MAWTVLLLGLLSHCTGSGTSYVLTQPASVSVAPGQTARITCGGSNLGSKSVNWYQLRPGQAPILVVYENKERPAGIPERLSALTSEETATLTISSVVAGDEADYFCQVWDTTSQQYVFGTGTQVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

• Full Name: immunoglobulin lambda constant 1 (Mcg marker)
• Calculated Molecular Weight: 233 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC007782
• Gene Symbol: IgG Lambda Light Chain
• Gene ID (NCBI): 3537
• RRID: AB_2878734
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This antibody detects the lambda light chain of human immunoglobulin.

Publications

What published studies show

The Human Ig Lambda Light Chain Polyclonal antibody (Cat# 20758-1-AP) has 2 published citations. These appear in iScience (2023), studying SFTSV infection and monoclonal plasma cell overproliferation, and Discover Oncology (2025), investigating IGLC1 as a prognostic marker and therapeutic target in osteosarcoma. The associated research fields span infectious disease immunology and oncology. Applications cited include IHC, IF, and WB in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC,IF	iScience; SFTSV infection is associated with transient overproliferation of monoclonal lambda-type plasma cells; Authors - Chuansong Quan
human	WB,IHC	Discov Oncol; IGLC1 is an independent prognostic marker and potent therapeutic target in osteosarcoma; Authors - Zhenjie Wu