Importin Beta Monoclonal antibody

Importin Beta Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67597-1-Ig
Clone No.1A12B1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

KPNB1, 1A12B1, IMB1, Impnb, Importin 90

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inIMR-32 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, A549 cells, Caco-2 cells, MDA-MB-231 cells, MOLT-4
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67597-1-Ig targets Importin Beta in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23094

Product name: Recombinant human KPNB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 408-605 aa of BC003572

Sequence: QAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD

Predict reactive species
Full Name karyopherin (importin) beta 1
Calculated Molecular Weight 97 kDa
Observed Molecular Weight 95-97 kDa
GenBank Accession NumberBC003572
Gene Symbol KPNB1
Gene ID (NCBI) 3837
RRIDAB_2882803
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14974
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Importin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623)

Protocols

Product Specific Protocols
IHC protocol for Importin Beta antibody 67597-1-IgDownload protocol
WB protocol for Importin Beta antibody 67597-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

J Transl Med

TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis

Authors - Xiang-Lin Hao
Loading...
||
New chat Able
正在加载,请稍候...