CoraLite® Plus 488-conjugated Importin Beta Monoclonal antibody

Importin Beta Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67597
Clone No.1A12B1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, FC (Intra)

KPNB1, 1A12B1, IMB1, Impnb, Importin 90

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67597 targets Importin Beta in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23094

Product name: Recombinant human KPNB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 408-605 aa of BC003572

Sequence: QAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD

Predict reactive species
Full Name karyopherin (importin) beta 1
Calculated Molecular Weight 97 kDa
Observed Molecular Weight 95-97 kDa
GenBank Accession NumberBC003572
Gene Symbol KPNB1
Gene ID (NCBI) 3837
RRIDAB_3084363
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14974
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Importin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Importin Beta antibody CL488-67597Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...