• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated KIAA1199 / CEMIP Polyclonal antibody

KIAA1199 / CEMIP Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-21129

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

CEMIP, KIAA1199, EC:3.2.1.35, Hyaluronan binding protein involved in hyaluronan depolymerization, HYBID

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21129 targets KIAA1199 / CEMIP in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15527

Product name: Recombinant human KIAA1199 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-386 aa of BC020256

Sequence: TVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFA

Predict reactive species
Full Name KIAA1199 / CEMIP
Calculated Molecular Weight 1361 aa, 153 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC020256
Gene Symbol KIAA1199
Gene ID (NCBI) 57214
RRIDAB_2919177
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUJ3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KIAA1199, also known as CEMIP, was first discovered as an inner-ear protein whose genetic mutations were linked to nonsyndromic hearing loss. KIAA1199 is involved in hyaluronan degradation. Studies have shown that KIAA1199 is overexpressed in many types of cancers, suggesting a critical role of KIAA1199 in cancer progression.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 KIAA1199 / CEMIP antibody CL488-21129Download protocol
IF protocol for CL Plus 488 KIAA1199 / CEMIP antibody CL488-21129Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...