LARG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LARG Polyclonal antibody, PBS Only (22441-1-PBS)

• 

  WB analysis of Jurkat using 22441-1-AP (same clone as 22441-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22441-1-AP (LARG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 22441-1-AP (same clone as 22441-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22441-1-AP (LARG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 22441-1-AP (same clone as 22441-1-PBS)

  IP result of anti-LARG (IP:22441-1-AP, 4ug; Detection:22441-1-AP 1:4000) with HEK-293 cells lysate 1320 ug. This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 22441-1-AP (same clone as 22441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis slide using 22441-1-AP (LARG Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 22441-1-AP (same clone as 22441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis slide using 22441-1-AP (LARG Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 22441-1-AP (same clone as 22441-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using ARHGEF12 antibody 22441-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22441-1-AP (same clone as 22441-1-PBS)

  Immunofluorescent analysis of HeLa cells using 22441-1-AP (LARG antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 22441-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LARG Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 22441-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

ARHGEF12, KIAA0382, Leukemia associated RhoGEF, Leukemia-associated RhoGEF

---

Product Information

22441-1-PBS targets LARG in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18211

  Product name: Recombinant human LARG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 214-563 aa of BC063117

  Sequence: QRLLKEIQEAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSM

• Full Name: Rho guanine nucleotide exchange factor (GEF) 12
• Calculated Molecular Weight: 1544 aa, 173 kDa
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: BC063117
• Gene Symbol: LARG
• Gene ID (NCBI): 23365
• RRID: AB_2879107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZN5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LARG, also known as ARHGEF12, is one of three regulator of G protein signalling (RGS) domain-containing RhoGEFs. LARG activates the ROCK pathway downstream of Gα12/13 signaling, leading to cytoskeletal reorganisation. LARG performs this activity either as a homodimer or as a heterodimer with Arhgef11. LARG has been implicated in many diseases, including cancer, heart disease, and in HIV viral replication. LARG is phosphorylated and dephosphorylated during mitosis and that Cdk1 is the mitotic kinase responsible for LARG phosphorylation. We got 220 kDa in western blotting, maybe due to its phosphorylation.