LARS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LARS Polyclonal antibody, PBS Only (21146-1-PBS)

• 

  WB analysis using 21146-1-AP (same clone as 21146-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21146-1-AP (LARS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21146-1-AP (same clone as 21146-1-PBS)

  WB result of LARS antibody (21146-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LARS transfected HeLa cells. This data was developed using the same antibody clone with 21146-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 21146-1-AP (same clone as 21146-1-PBS)

  IP result of anti-LARS (IP:21146-1-AP, 4ug; Detection:21146-1-AP 1:500) with Jurkat cells lysate 2400ug. This data was developed using the same antibody clone with 21146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 21146-1-AP (same clone as 21146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21146-1-AP (LARS Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 21146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 21146-1-AP (same clone as 21146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21146-1-AP (LARS Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 21146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21146-1-AP (same clone as 21146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using LARS antibody (21146-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21146-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LARS Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 21146-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

21146-1-PBS targets LARS in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15684

  Product name: Recombinant human LARS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 827-1176 aa of BC151214

  Sequence: EFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMNASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPAKGKKTDKQPLQKPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKLPDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQLEFDEKAVLMENIVYLTNSLELEHIEVKFASEAEDKIREDCCPGKPLNVFRIEPGVSVSLVNPQPSNGHFSTKIEIRQGDNCDSIIRRLMKMNRGIKDLSKVKLMRFDDPLLGPRRVPVLGKEYTEKTPISEHAVFNVDLMSKKIHLTENGIRVDIGDTIIYLVH

• Full Name: leucyl-tRNA synthetase
• Calculated Molecular Weight: 1176 aa, 134 kDa
• Observed Molecular Weight: 135-140 kDa
• GenBank Accession Number: BC151214
• Gene Symbol: LARS
• Gene ID (NCBI): 51520
• RRID: AB_10733878
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2J5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.