• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated LIMK1 Monoclonal antibody

LIMK1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67974
Clone No.2B11E9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC, FC (Intra)

2B11E9, EC:2.7.11.1, LIM domain kinase 1, LIMK, LIMK 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67974 targets LIMK1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28862

Product name: Recombinant human LIMK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 67-222 aa of BC152982

Sequence: DGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDR

Predict reactive species
Full Name LIM domain kinase 1
Calculated Molecular Weight 647 aa, 73 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberBC152982
Gene Symbol LIMK1
Gene ID (NCBI) 3984
RRIDAB_3672967
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP53667
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LIMK1,also named LIMK, belongs to the protein kinase superfamily and TKL Ser/Thr protein kinase family. LIMK1 is a protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. LIMK1 may be involved in brain development. The antibody has no cross-reaction with LIMK2.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 LIMK1 antibody CL488-67974Download protocol
IF protocol for CL Plus 488 LIMK1 antibody CL488-67974Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...