LMCD1 Monoclonal antibody, PBS Only

LMCD1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 67834-1-PBS
Clone No.2A7B3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Dyxin, LMCD1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67834-1-PBS targets LMCD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28331

Product name: Recombinant human LMCD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-365 aa of BC000646

Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Predict reactive species
Full Name LIM and cysteine-rich domains 1
Calculated Molecular Weight 41 kDa
Observed Molecular Weight~40 kDa
GenBank Accession NumberBC000646
Gene Symbol LMCD1
Gene ID (NCBI) 29995
RRIDAB_2918596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZU5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LIM and cysteine-rich domains-1 (LMCD1) is a member of the LIM protein family, which contains an N-terminal cysteine-rich region, two C-terminal LIM domains and a central PET (Prickle, Espinas, and Testin) domain. LMCD1 has been reported in cardiac tissues and lung acting as a transcriptional repressor for GATA6. The mutations of LMCD1 promote cell migration and tumor metastasis in hepatocellular carcinoma. (PMID: 31501411) It has calculated molecular weight around 41kDa.

Loading...
||
New chat Able
正在加载,请稍候...