LPXN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LPXN Polyclonal antibody, PBS Only (11307-1-PBS)

• 

  WB analysis using 11307-1-AP (same clone as 11307-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11307-1-AP (LPXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11307-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 11307-1-AP (same clone as 11307-1-PBS)

  WB result of LPXN antibody (11307-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LPXN transfected PC-3 cells. This data was developed using the same antibody clone with 11307-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 11307-1-AP (same clone as 11307-1-PBS)

  IP result of anti-LPXN (IP:11307-1-AP, 4ug; Detection:11307-1-AP 1:5000) with PC-3 cells lysate 1575 ug. This data was developed using the same antibody clone with 11307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11307-1-AP (same clone as 11307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11307-1-AP (LPXN antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11307-1-AP (same clone as 11307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11307-1-AP (LPXN antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11307-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 11307-1-AP (same clone as 11307-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using LPXN antibody (11307-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 11307-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LPXN Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11307-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

LDLP, LDPL

---

Product Information

11307-1-PBS targets LPXN in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1845

  Product name: Recombinant human LPXN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 87-386 aa of BC019035

  Sequence: TSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL

• Full Name: leupaxin
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC019035
• Gene Symbol: LPXN
• Gene ID (NCBI): 9404
• RRID: AB_2877756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60711
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LPXN, also known as Leupaxin, LDPL, belongs to the paxillin family. LPXN Contributes to the regulation of cell adhesion, spreading, and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events (PMID: 20543562). LPXN has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of the focal adhesion kinase family (PMID: 9565592). Studies in breast cancer implicate LPXN is involved in the regulation of ER action as a co-factor (PMID: 25955236). LPXN is expressed in prostate cancer cells and its expression intensity is directly linked to PCa progression (PMID: 18451096).