• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MDH1 Polyclonal antibody

MDH1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-15904

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Aromatic alpha-keto acid reductase, EC:1.1.1.37, EC:1.1.1.96, KAR, MDHA

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15904 targets MDH1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8744

Product name: Recombinant human MDH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-334 aa of BC001484

Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Predict reactive species
Full Name malate dehydrogenase 1, NAD (soluble)
Calculated Molecular Weight 334 aa, 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC001484
Gene Symbol MDH1
Gene ID (NCBI) 4190
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40925
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme.(PMID:10693743)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MDH1 antibody CL488-15904Download protocol
FC protocol for CL Plus 488 MDH1 antibody CL488-15904Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...