MUC5B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MUC5B Polyclonal antibody, PBS Only (28118-1-PBS)

MUC5B Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 28118-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

MUC9, MUC5, MG1

• 

  IHC staining of human lung using 28118-1-AP (same clone as 28118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 28118-1-AP (MUC5B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28118-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 28118-1-AP (same clone as 28118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 28118-1-AP (MUC5B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28118-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 28118-1-AP (same clone as 28118-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using MUC5B antibody (28118-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28118-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 28118-1-AP (same clone as 28118-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using MUC5B antibody (28118-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28118-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MUC5B in ?

Chat with Able

---

Product Information

28118-1-PBS targets MUC5B in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27886

  Product name: Recombinant human MUC5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 5548-5716 aa of NM_002458

  Sequence: MLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGECVQTACLTPDGQPVQLNETWVNSHVDNCTVYLCEAEGGVHLLTPQPASCPDVSSCRGSLRKTGCCYSCEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVP

• Full Name: mucin 5B, oligomeric mucus/gel-forming
• Calculated Molecular Weight: 596 kDa
• GenBank Accession Number: NM_002458
• Gene Symbol: MUC5B
• Gene ID (NCBI): 727897
• RRID: AB_2881067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HC84
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.