MYL6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYL6 Polyclonal antibody, PBS Only (18158-1-PBS)

• 

  WB analysis using 18158-1-AP (same clone as 18158-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18158-1-AP (MYL6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18158-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 18158-1-AP (same clone as 18158-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 18158-1-AP (MYL6 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18158-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 18158-1-AP (same clone as 18158-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using MYL6 antibody (18158-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18158-1-PBS in a different storage buffer formulation.

MYL6 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 18158-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MYL 6, MLC-3

---

Product Information

18158-1-PBS targets MYL6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12964

  Product name: Recombinant human MYL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC006781

  Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

• Full Name: myosin, light chain 6, alkali, smooth muscle and non-muscle
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC006781
• Gene Symbol: MYL6
• Gene ID (NCBI): 4637
• RRID: AB_3085557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60660
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814).