Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated NDUFB7 Monoclonal antibody

NDUFB7 Monoclonal Antibody for FC (Intra)

Cat No. CL488-68362
Clone No.1H8C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

FC (Intra)

1H8C1, B18, Cell adhesion protein SQM1, CI B18, CI-B18

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68362 targets NDUFB7 in FC (Intra) applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6720

Product name: Recombinant human NDUFB7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-137 aa of BC002595

Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Calculated Molecular Weight 16 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002595
Gene Symbol NDUFB7
Gene ID (NCBI) 4713
RRIDAB_3084479
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP17568
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 NDUFB7 antibody CL488-68362Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...