NDUFB8 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of A549 using 67690-1-Ig (same clone as 67690-1-PBS)

  WB result of NDUFB8 antibody (67690-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDUFB8 transfected A549 cells. This data was developed using the same antibody clone with 67690-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67690-1-Ig (same clone as 67690-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67690-1-Ig (NDUFB8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67690-1-Ig (same clone as 67690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67690-1-Ig (NDUFB8 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67690-1-Ig (same clone as 67690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67690-1-Ig (NDUFB8 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 67690-1-Ig (same clone as 67690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67690-1-Ig (NDUFB8 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67690-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50307-1

  Cytometric bead array standard curve of MP50307-1, NDUFB8 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67690-1-PBS. Detection antibody: 67690-2-PBS. Standard:Ag6569. Range: 0.098-6.25 ng/mL.

• 

  Cytometric bead array standard curve of MP50307-2

  Cytometric bead array standard curve of MP50307-2, NDUFB8 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67690-1-PBS. Detection antibody: 67690-3-PBS. Standard:Ag6569. Range: 0.098-25 ng/mL.

• Featured Product
• KD/KO Validated

NDUFB8 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 67690-1-PBS

Clone No.3B12C6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

3B12C6, ASHI, CI ASHI, CIASHI, CI-ASHI

---

Product Information

67690-1-PBS targets NDUFB8 as part of a matched antibody pair:

MP50307-1: 67690-1-PBS capture and 67690-2-PBS detection (validated in Cytometric bead array)

MP50307-2: 67690-1-PBS capture and 67690-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6569

  Product name: Recombinant human NDUFB8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-186 aa of BC000466

  Sequence: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

• Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 18-22 kDa
• GenBank Accession Number: BC000466
• Gene Symbol: NDUFB8
• Gene ID (NCBI): 4714
• RRID: AB_2882883
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95169
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.