CoraLite® Plus 488-conjugated NEU1 Monoclonal antibody

• 

  IF Staining of U-251 using CL488-67032

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using CoraLite® Plus 488 NEU1 antibody (CL488-67032, Clone: 1F6D1 ) at dilution of 1:200.

NEU1 Monoclonal Antibody for IF/ICC

Cat No. CL488-67032

Clone No.1F6D1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

IF/ICC

Synonyms

1F6D1, Acetylneuraminyl hydrolase, EC:3.2.1.18, G9 sialidase, Lysosomal sialidase

---

Tested Applications

• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67032 targets NEU1 in IF/ICC applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27945

  Product name: Recombinant human NEU1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-415 aa of BC011900

  Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

• Full Name: sialidase 1 (lysosomal sialidase)
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC011900
• Gene Symbol: NEU1
• Gene ID (NCBI): 4758
• RRID: AB_3084301
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q99519
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal silic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflamation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Addition, it is reported that mutation in NEU1 of human could lead to sialidosis (PMID:14517945).