CoraLite® Plus 488-conjugated NEU1 Monoclonal antibody

NEU1 Monoclonal Antibody for IF/ICC
Cat No. CL488-67032
Clone No.1F6D1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

IF/ICC

1F6D1, Acetylneuraminyl hydrolase, EC:3.2.1.18, G9 sialidase, Lysosomal sialidase

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU-251 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67032 targets NEU1 in IF/ICC applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27945

Product name: Recombinant human NEU1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 96-415 aa of BC011900

Sequence: ARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Predict reactive species
Full Name sialidase 1 (lysosomal sialidase)
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45-48 kDa
GenBank Accession NumberBC011900
Gene Symbol NEU1
Gene ID (NCBI) 4758
RRIDAB_3084301
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99519
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NEU1 (lysosomal sialidase) encodes a kind of lysosomal enzyme that could cleave terminal silic acids from glycoproteins or glycolipids to regulate various biological processes by conformational change (PMID:28130415). In the lysosome, NEU1 is one member of a heterotrimeric complex, the others are beta-galactosidase and cathepsin A. The NEU1 is widely expressed in mammalian tissues and involved in lysosomal storage disorder sialidosis, autoimmune diseases and the malignancy and metastasis of cancer cells (PMID:19075514). NUE1 also expresses on the plasma membrane where it modulates several signalling molecules about inflamation, exocytosis, phagocytosis, cell adhesion and proliferation (PMID:21928149). Addition, it is reported that mutation in NEU1 of human could lead to sialidosis (PMID:14517945).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NEU1 antibody CL488-67032Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...