CoraLite® Plus 647 Anti-Mouse NKp46/NCR1 Rabbit Recombinant Antibody

NKp46/NCR1 Uni-rAb® Recombinant Antibody for FC
Cat No. CL647-98198
Clone No.241804A12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Ncr1, 241804A12, Activating receptor 1, CD335, Ly94

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98198 targets NKp46/NCR1 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1825

Product name: Recombinant Mouse NKp46/NCR1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 17-255 aa of NM_010746.3

Sequence: QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN

Predict reactive species
Full Name natural cytotoxicity triggering receptor 1
Calculated Molecular Weight37kDa
GenBank Accession NumberNM_010746.3
Gene Symbol NKp46/NCR1
Gene ID (NCBI) 17086
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8C567
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

NKp46, also known as NCR1 or CD335, is an Ig-like superfamily cell surface receptor that is highly conserved in mammals (PMID: 22021440). NKp46 is a type I transmembrane glycoprotein consisting of two extracellular Ig-like domains, a transmembrane domain, and an intracellular tail (PMID: 9730896). It is expressed on NK cells, rare T-cell subsets and a mucosal population of NKp46+ innate lymphoid cells (PMID: 9730896; 22021440). NKp46 is the major triggering receptor involved in the natural cytotoxicity (PMID: 10359120; 10092106; 15356098).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 NKp46/NCR1 antibody CL647-98198Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...