CoraLite® Plus 750 Anti-Mouse NKp46/NCR1 Rabbit Recombinant Antibody

NKp46/NCR1 Uni-rAb® Recombinant Antibody for FC
Cat No. CL750-98198
Clone No.241804A12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Ncr1, 241804A12, Activating receptor 1, CD335, Ly94

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-98198 targets NKp46/NCR1 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1825

Product name: Recombinant Mouse NKp46/NCR1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 17-255 aa of NM_010746.3

Sequence: QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN

Predict reactive species
Full Name natural cytotoxicity triggering receptor 1
Calculated Molecular Weight37kDa
GenBank Accession NumberNM_010746.3
Gene Symbol NKp46/NCR1
Gene ID (NCBI) 17086
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8C567
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

NKp46, also known as NCR1 or CD335, is an Ig-like superfamily cell surface receptor that is highly conserved in mammals (PMID: 22021440). NKp46 is a type I transmembrane glycoprotein consisting of two extracellular Ig-like domains, a transmembrane domain, and an intracellular tail (PMID: 9730896). It is expressed on NK cells, rare T-cell subsets and a mucosal population of NKp46+ innate lymphoid cells (PMID: 9730896; 22021440). NKp46 is the major triggering receptor involved in the natural cytotoxicity (PMID: 10359120; 10092106; 15356098).

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 NKp46/NCR1 antibody CL750-98198Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...