Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue |
| Positive IHC detected in | mouse cerebellum tissue, rat cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, rat cerebellum tissue, mouse cerebellum tissue |
| Positive IF-Fro detected in | mouse brain tissue |
| Positive FC (Intra) detected in | U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:12000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26975-1-AP targets NeuN in WB, IHC, IF-P, IF-Fro, FC (Intra), Dot blot, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| Observed Molecular Weight | 46-52 kDa |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| RRID | AB_2880708 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Function
NeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).
Tissue specificity
NeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).
Involvement in disease
· NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).
Isoforms
There are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).
Post-translational modifications
Currently not known.
Cellular localization
NeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NeuN antibody 26975-1-AP | Download protocol |
| IHC protocol for NeuN antibody 26975-1-AP | Download protocol |
| WB protocol for NeuN antibody 26975-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NeuN Polyclonal antibody (Cat# 26975-1-AP) has accumulated 567 citations in high-impact journals including Nature, Neuron, Nature Medicine, Nature Neuroscience, Nature Communications, Cell Metabolism, Immunity, Cancer Discovery, Brain, and J Neuroinflammation. Research fields cover neurodegeneration (Alzheimer's, Parkinson's, Huntington's disease), stroke, traumatic brain injury, spinal cord injury, epilepsy, neuroinflammation, ferroptosis, pyroptosis, gut-brain axis, neuropathic pain, and mitochondrial biology. Primary applications include IF, IHC, and WB.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Extracellular RNAs-TLR3 signaling contributes to cognitive impairment after chronic neuropathic pain in mice | ||
Cell Metab Aging-induced tRNAGlu-derived fragment impairs glutamate biosynthesis by targeting mitochondrial translation-dependent cristae organization | ||
Immunity Fate mapping of Spp1 expression reveals age-dependent plasticity of disease-associated microglia-like cells after brain injury | ||
Immunity Innate immune sensing of Z-nucleic acids by ZBP1-RIPK1 axis drives neuroinflammation in Alzheimer's disease. |
Reviews
What customers say
Users consistently rate this NeuN antibody highly, with most reviews giving 5 stars. It delivers strong, specific nuclear staining with low background across brain sections, organoids, induced neurons, and cell lines. Common applications include immunofluorescence (1:100–1:500), IHC, and Western blot (1:1:1000). Several users highlight clean labeling suitable for double-staining and co-localization studies. One reviewer noted mild non-specific binding in mixed cell cultures, recommending titration. Overall, users find it reliable for neuronal identification in both fixed tissues and cultured cells.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ahmad (Verified Customer) (04-29-2026) | Good antibody for IF
|
Víct0r (Verified Customer) (07-24-2025) | In my case, this antibody doesn't seem very specific. It binds to cells that are not neurons. However, in pure neuronal cultures, it works well, although there is a bit of background. I’ve just seen that titrating this reagent is recommended, but in this case, it wasn’t titrated.
 |
Raquel (Verified Customer) (07-12-2024) | Nice and clean staining. Immunofluorescence analysis in cryostat sections of 4% PFA fixed human brain organoid derived from iPSCs using 26975-1-AP NeuN antibody at dilution of 1:250 (under 20x lens). (Magenta: NeuN ; Blue: DAPI)
 |
Manohar (Verified Customer) (03-06-2024) |
|
Damien (Verified Customer) (02-15-2024) | Works well in 2D staining of induced neurons, starting at 14days. Fixed and permeabilized with 3%BSA and 0.1% Triton
|
Monika (Verified Customer) (06-08-2023) | Very specific and strong signal. Used without antigen retrieval. Worked good for both NBT/BCIP-colorimetry and Alexa fluor-fluorescence detection.
|
Russell (Verified Customer) (05-23-2023) | Antigen heat retrieval with Citrate buffer pH 6.0 at 100C for 20 min Permeabilized with 1% TX-100 Blocking Buffer PBST with 5% Donkey Serum
|
Irina (Verified Customer) (11-18-2021) | Good specific neuronal signal. Works nicely for double IF to look at co-localisation with other proteins.
|
David (Verified Customer) (01-13-2020) | Good nuclear localisation, with strong signal and low background.
|
Maxence (Verified Customer) (09-05-2019) | Labeling was neat without any background. Signal was quite strong and stable.
|
Elena (Verified Customer) (07-31-2019) | Good antibody, stained in all cell lines we used it for.
|
Kaspar (Verified Customer) (01-26-2018) |
|
