APC Anti-Mouse Neutrophil Elastase Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• APC Anti-Mouse Neutrophil Elastase Rabbit Recombinant Antibody (APC-98197)

Neutrophil Elastase Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. APC-98197 Copied!

Clone No. 241842G3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

241842G3, EC:3.4.21.37, Ela2, Elane, Elastase-2

• 

  FC experiment of mouse bone marrow cells using APC-98197

  1x10^6 mouse bone marrow cells (left) or NIH/3T3 cells (right) were intracellularly stained with 0.1 ug APC Anti-Mouse Neutrophil Elastase Rabbit RecAb (APC-98197, Clone: 241842G3) (red) or APC Rabbit IgG Isotype Control Recombinant Antibody (APC-98136, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Neutrophil Elastase in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-98197 targets Neutrophil Elastase in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2126

  Product name: Recombinant Mouse Neutrophil elastase protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-260 aa of NM_015779.2

  Sequence: SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDR

• Full Name: elastase 2, neutrophil
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_015779.2
• Gene Symbol: Ela2
• Gene ID (NCBI): 50701
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q3UP87
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

ELA2 (Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation (PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation) (PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration (PMID:9683424).