FITC Plus Anti-Mouse Neutrophil elastase Rabbit Recombinant Antibody

Neutrophil elastase Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. FITC-98197
Clone No.241842G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

241842G3, EC:3.4.21.37, Ela2, Elane, Elastase-2

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inmouse bone marrow cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98197 targets Neutrophil elastase in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2126

Product name: Recombinant Mouse Neutrophil elastase protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 27-260 aa of NM_015779.2

Sequence: SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDR

Predict reactive species
Full Name elastase 2, neutrophil
Calculated Molecular Weight29 kDa
GenBank Accession NumberNM_015779.2
Gene Symbol Ela2
Gene ID (NCBI) 50701
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ3UP87
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

ELA2 (Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation (PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation) (PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration (PMID:9683424).

Protocols

Product Specific Protocols
FC protocol for FITC Plus Neutrophil elastase antibody FITC-98197Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...