CoraLite®594-conjugated PADI2 Monoclonal antibody

• 

  IF Staining of human breast cancer using CL594-66386

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CL594-66386 (PADI2 antibody) at dilution of 1:50.

• 

  IF Staining of HeLa using CL594-66386

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 PADI2 antibody (CL594-66386, Clone: 2D8C12 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-66386

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite®594 Anti-Human PADI2 (CL594-66386, Clone:2D8C12) (red), or 0.8 ug CoraLite®594 Mouse IgG2b Isotype Control (MPC-11) (CL594-65128, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

PADI2 Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)

Cat No. CL594-66386

Clone No.2D8C12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P, FC (Intra)

Synonyms

PADI2 protein, PAD-H19, PAD2, PAD H19, KIAA0994

---

Tested Applications

• Positive IF-P detected in: human breast cancer tissue, HeLa cells
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66386 targets PADI2 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17612

  Product name: Recombinant human PADI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-438 aa of BC009701

  Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL

• Full Name: peptidyl arginine deiminase, type II
• Calculated Molecular Weight: 665 aa, 75 kDa
• GenBank Accession Number: BC009701
• Gene Symbol: PADI2
• Gene ID (NCBI): 11240
• RRID: AB_2883573
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y2J8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PADI2, also named as KIAA0994, PDI2, PAD-H19, and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation-related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa. This antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.